SCOP 1.73: Domain d2oqia2: 2oqi A:509-764

Lineage for d2oqia2 (2oqi A:509-764)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)

8. Domain d2oqia2: 2oqi A:509-764 [139241]
   Other proteins in same PDB: d2oqia1, d2oqib1, d2oqic1, d2oqid1
   automatically matched to d1orva2
   complexed with ggo

Details for d2oqia2

PDB Entry: 2oqi, 2.8 Å

PDB Description: human dipeptidyl peptidase iv (dpp4) with piperidinone-constrained phenethylamine

PDB Compounds: (A:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP)

SCOP Domain Sequences for d2oqia2:

Sequence; same for both SEQRES and ATOM records:

>d2oqia2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d2oqia2:

• d2oqia2 is new in SCOP 1.73
  
• d2oqia2 appears in SCOP 1.75
  
• d2oqia2 appears in the current release, SCOPe 2.08