Lineage for d2oqef1 (2oqe F:237-672)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664385Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 664386Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 664387Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 664472Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 664478Domain d2oqef1: 2oqe F:237-672 [139237]
    Other proteins in same PDB: d2oqea2, d2oqea3, d2oqeb2, d2oqeb3, d2oqec2, d2oqec3, d2oqed2, d2oqed3, d2oqee2, d2oqee3, d2oqef2, d2oqef3
    automatically matched to d1a2va1
    complexed with cu, gol, sme, xe

Details for d2oqef1

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms
PDB Compounds: (F:) Peroxisomal copper amine oxidase

SCOP Domain Sequences for d2oqef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqef1 b.30.2.1 (F:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOP Domain Coordinates for d2oqef1:

Click to download the PDB-style file with coordinates for d2oqef1.
(The format of our PDB-style files is described here.)

Timeline for d2oqef1: