Lineage for d2oqeb2 (2oqe B:18-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2543046Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2543047Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2543255Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 2543258Domain d2oqeb2: 2oqe B:18-115 [139226]
    Other proteins in same PDB: d2oqea1, d2oqeb1, d2oqec1, d2oqed1, d2oqee1, d2oqef1
    automatically matched to d1ekma2
    complexed with cu, gol, xe

Details for d2oqeb2

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms
PDB Compounds: (B:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oqeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqeb2 d.17.2.1 (B:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOPe Domain Coordinates for d2oqeb2:

Click to download the PDB-style file with coordinates for d2oqeb2.
(The format of our PDB-style files is described here.)

Timeline for d2oqeb2: