![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein Tyrosine-protein kinase zap-70 [89996] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries) |
![]() | Domain d2oq1a2: 2oq1 A:135-258 [139221] automatically matched to d1m61a2 complexed with pb |
PDB Entry: 2oq1 (more details), 1.9 Å
SCOPe Domain Sequences for d2oq1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke acpn
Timeline for d2oq1a2: