Lineage for d2opzc_ (2opz C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642795Protein BIR domains of XIAP [57928] (1 species)
  7. 2642796Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 2642822Domain d2opzc_: 2opz C: [139218]
    automated match to d1tfqa_
    complexed with zn

Details for d2opzc_

PDB Entry: 2opz (more details), 3 Å

PDB Description: avpf bound to bir3-xiap
PDB Compounds: (C:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d2opzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opzc_ g.52.1.1 (C:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

SCOPe Domain Coordinates for d2opzc_:

Click to download the PDB-style file with coordinates for d2opzc_.
(The format of our PDB-style files is described here.)

Timeline for d2opzc_: