Lineage for d2opzb_ (2opz B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038108Protein BIR domains of XIAP [57928] (1 species)
  7. 3038109Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 3038138Domain d2opzb_: 2opz B: [139217]
    automated match to d1tfqa_
    complexed with zn

    has additional insertions and/or extensions that are not grouped together

Details for d2opzb_

PDB Entry: 2opz (more details), 3 Å

PDB Description: avpf bound to bir3-xiap
PDB Compounds: (B:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d2opzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opzb_ g.52.1.1 (B:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

SCOPe Domain Coordinates for d2opzb_:

Click to download the PDB-style file with coordinates for d2opzb_.
(The format of our PDB-style files is described here.)

Timeline for d2opzb_: