![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
![]() | Protein HIV-1 reverse transcriptase [56689] (4 species) |
![]() | Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries) |
![]() | Domain d2opqb_: 2opq B: [139214] Other proteins in same PDB: d2opqa2 automated match to d2oppb_ complexed with hbq, po4; mutant |
PDB Entry: 2opq (more details), 2.8 Å
SCOPe Domain Sequences for d2opqb_:
Sequence, based on SEQRES records: (download)
>d2opqb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik kkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpldedf rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk lwyq
>d2opqb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik kkdstkwrklvdfrelnkrtqdfhpagikkkksvtvldvgdayfsvpldedfrkytafti psinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsd leigqhrtkieelrqhllrwgppflwmgyelhpdkwtvqpivlpekdswtvndiqklvgk lnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpsk dliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpk fklpiqketwetwwteywqatwipewefvntpplvklwyq
Timeline for d2opqb_: