Lineage for d2opod_ (2opo D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 915069Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 915073Protein Polcalcin Che a 3 [109816] (1 species)
  7. 915074Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry)
    Uniprot Q84V36
  8. 915078Domain d2opod_: 2opo D: [139212]
    automated match to d1pmzc_
    complexed with ca, so4

Details for d2opod_

PDB Entry: 2opo (more details), 1.75 Å

PDB Description: Crystal structure of the calcium-binding pollen allergen Che a 3
PDB Compounds: (D:) Polcalcin Che a 3

SCOPe Domain Sequences for d2opod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opod_ a.39.1.10 (D:) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
fdeftdfaranrglvkdvskif

SCOPe Domain Coordinates for d2opod_:

Click to download the PDB-style file with coordinates for d2opod_.
(The format of our PDB-style files is described here.)

Timeline for d2opod_: