![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.10: Polcalcin [89048] (3 proteins) calcium-binding pollen allergen; two EF-hands per subunit |
![]() | Protein Polcalcin Che a 3 [109816] (1 species) |
![]() | Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry) Uniprot Q84V36 |
![]() | Domain d2opod_: 2opo D: [139212] automated match to d1pmzc_ complexed with ca, so4 |
PDB Entry: 2opo (more details), 1.75 Å
SCOPe Domain Sequences for d2opod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2opod_ a.39.1.10 (D:) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis fdeftdfaranrglvkdvskif
Timeline for d2opod_: