SCOP 1.75: Domain d2opob1: 2opo B:6-86

Lineage for d2opob1 (2opo B:6-86)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.10: Polcalcin [89048] (3 proteins)
   calcium-binding pollen allergen; two EF-hands per subunit

6. Protein Polcalcin Che a 3 [109816] (1 species)

7. Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry)
   Uniprot Q84V36

8. Domain d2opob1: 2opo B:6-86 [139210]
   automatically matched to d1pmzc_
   complexed with ca, so4

Details for d2opob1

PDB Entry: 2opo, 1.75 Å

PDB Description: Crystal structure of the calcium-binding pollen allergen Che a 3

PDB Compounds: (B:) Polcalcin Che a 3

SCOP Domain Sequences for d2opob1:

Sequence; same for both SEQRES and ATOM records:

>d2opob1 a.39.1.10 (B:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
tpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfisf
deftdfaranrglvkdvskif

Timeline for d2opob1:

• d2opob1 first appeared in SCOP 1.73
  
• d2opob1 is called d2opob_ in SCOPe 2.01
  
• d2opob1 appears in the current release, SCOPe 2.08, called d2opob_