Lineage for d2opoa1 (2opo A:6-86)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641375Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 641379Protein Polcalcin Che a 3 [109816] (1 species)
  7. 641380Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry)
  8. 641381Domain d2opoa1: 2opo A:6-86 [139209]
    automatically matched to d1pmzc_
    complexed with ca, so4

Details for d2opoa1

PDB Entry: 2opo (more details), 1.75 Å

PDB Description: Crystal structure of the calcium-binding pollen allergen Che a 3
PDB Compounds: (A:) Polcalcin Che a 3

SCOP Domain Sequences for d2opoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
tpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfisf
deftdfaranrglvkdvskif

SCOP Domain Coordinates for d2opoa1:

Click to download the PDB-style file with coordinates for d2opoa1.
(The format of our PDB-style files is described here.)

Timeline for d2opoa1: