SCOP 1.75: Domain d2opha2: 2oph A:509-766

Lineage for d2opha2 (2oph A:509-766)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)

8. Domain d2opha2: 2oph A:509-766 [139206]
   Other proteins in same PDB: d2opha1, d2ophb1
   automatically matched to d1orva2
   complexed with 277, na, nag, ndg; mutant

Details for d2opha2

PDB Entry: 2oph, 2.4 Å

PDB Description: human dipeptidyl peptidase iv in complex with an alpha amino acid inhibitor

PDB Compounds: (A:) Dipeptidyl peptidase 4 soluble form

SCOP Domain Sequences for d2opha2:

Sequence; same for both SEQRES and ATOM records:

>d2opha2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2opha2:

• d2opha2 first appeared in SCOP 1.73
  
• d2opha2 appears in SCOPe 2.01
  
• d2opha2 appears in the current release, SCOPe 2.08