SCOPe 2.08: Domain d2op3b_: 2op3 B:

Lineage for d2op3b_ (2op3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d2op3b_: 2op3 B: [139204]
   automated match to d1ms6a_
   complexed with peu, so4, tf5

Details for d2op3b_

PDB Entry: 2op3, 1.6 Å

PDB Description: The structure of cathepsin S with a novel 2-arylphenoxyacetaldehyde inhibitor derived by the Substrate Activity Screening (SAS) method

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2op3b_:

Sequence; same for both SEQRES and ATOM records:

>d2op3b_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2op3b_:

• d2op3b_ first appeared in SCOP 1.73, called d2op3b1
  
• d2op3b_ appears in SCOPe 2.07