Lineage for d2op3a_ (2op3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2533866Protein (Pro)cathepsin S [82566] (1 species)
  7. 2533867Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2533872Domain d2op3a_: 2op3 A: [139203]
    automated match to d1ms6a_
    complexed with peu, so4, tf5

Details for d2op3a_

PDB Entry: 2op3 (more details), 1.6 Å

PDB Description: The structure of cathepsin S with a novel 2-arylphenoxyacetaldehyde inhibitor derived by the Substrate Activity Screening (SAS) method
PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2op3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op3a_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d2op3a_:

Click to download the PDB-style file with coordinates for d2op3a_.
(The format of our PDB-style files is described here.)

Timeline for d2op3a_: