Lineage for d2oovd1 (2oov D:237-672)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1535037Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 1535047Domain d2oovd1: 2oov D:237-672 [139188]
    Other proteins in same PDB: d2oova2, d2oova3, d2oovb2, d2oovb3, d2oovc2, d2oovc3, d2oovd2, d2oovd3, d2oove2, d2oove3, d2oovf2, d2oovf3
    automatically matched to d1a2va1
    complexed with cu, gol, po4

Details for d2oovd1

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (D:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oovd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovd1 b.30.2.1 (D:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d2oovd1:

Click to download the PDB-style file with coordinates for d2oovd1.
(The format of our PDB-style files is described here.)

Timeline for d2oovd1: