Lineage for d2oovc3 (2oov C:116-236)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1019765Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1019766Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1019767Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1019951Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 1019969Domain d2oovc3: 2oov C:116-236 [139187]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1a2va3
    complexed with cu, gol, po4

Details for d2oovc3

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (C:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oovc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovc3 d.17.2.1 (C:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOPe Domain Coordinates for d2oovc3:

Click to download the PDB-style file with coordinates for d2oovc3.
(The format of our PDB-style files is described here.)

Timeline for d2oovc3: