| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
| Domain d2oovc2: 2oov C:18-115 [139186] Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1 automatically matched to d1ekma2 complexed with cu, gol, po4 |
PDB Entry: 2oov (more details), 1.7 Å
SCOPe Domain Sequences for d2oovc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oovc2 d.17.2.1 (C:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi
Timeline for d2oovc2: