Lineage for d2oovc2 (2oov C:18-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640720Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 1640737Domain d2oovc2: 2oov C:18-115 [139186]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1ekma2
    complexed with cu, gol, po4

Details for d2oovc2

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (C:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oovc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovc2 d.17.2.1 (C:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOPe Domain Coordinates for d2oovc2:

Click to download the PDB-style file with coordinates for d2oovc2.
(The format of our PDB-style files is described here.)

Timeline for d2oovc2: