Lineage for d2oovb3 (2oov B:116-236)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718737Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 718903Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 718919Domain d2oovb3: 2oov B:116-236 [139184]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1a2va3
    complexed with cu, gol, po4, sme

Details for d2oovb3

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (B:) Peroxisomal copper amine oxidase

SCOP Domain Sequences for d2oovb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovb3 d.17.2.1 (B:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOP Domain Coordinates for d2oovb3:

Click to download the PDB-style file with coordinates for d2oovb3.
(The format of our PDB-style files is described here.)

Timeline for d2oovb3: