Lineage for d2oova2 (2oov A:18-115)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855587Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 855600Domain d2oova2: 2oov A:18-115 [139180]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1ekma2
    complexed with cu, gol, po4, sme

Details for d2oova2

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (A:) Peroxisomal copper amine oxidase

SCOP Domain Sequences for d2oova2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oova2 d.17.2.1 (A:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOP Domain Coordinates for d2oova2:

Click to download the PDB-style file with coordinates for d2oova2.
(The format of our PDB-style files is described here.)

Timeline for d2oova2: