SCOPe 2.06: Domain d2oota1: 2oot A:594-750

Lineage for d2oota1 (2oot A:594-750)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family)
   automatically mapped to Pfam PF04253

5. Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)

6. Protein Glutamate carboxypeptidase II [140574] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140575] (24 PDB entries)
   Uniprot Q04609 594-750

8. Domain d2oota1: 2oot A:594-750 [139176]
   Other proteins in same PDB: d2oota2, d2oota3
   automatically matched to 2C6C A:594-750
   complexed with ca, cl, nag, zn

Details for d2oota1

PDB Entry: 2oot, 1.64 Å

PDB Description: a high resolution structure of ligand-free human glutamate carboxypeptidase ii

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2oota1:

Sequence, based on SEQRES records:

>d2oota1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records):

>d2oota1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
npivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdie
skvdpskawgevkrqiyvaaftvqaaaetlseva

Timeline for d2oota1:

• d2oota1 first appeared in SCOP 1.73
  
• d2oota1 appears in SCOPe 2.05
  
• d2oota1 appears in SCOPe 2.07
  
• d2oota1 appears in the current release, SCOPe 2.08