SCOP 1.75: Domain d2oorb2: 2oor B:1-143,B:327-378

Lineage for d2oorb2 (2oor B:1-143,B:327-378)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d2oorb2: 2oor B:1-143,B:327-378 [139174]
   Other proteins in same PDB: d2oora1, d2oorb1, d2oorc1
   automatically matched to d1f8ga2
   complexed with gol, nad, txp

Details for d2oorb2

PDB Entry: 2oor, 2.32 Å

PDB Description: structure of transhydrogenase (di.nad+)2(diii.h2nadph)1 asymmetric complex

PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d2oorb2:

Sequence; same for both SEQRES and ATOM records:

>d2oorb2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

Timeline for d2oorb2:

• d2oorb2 first appeared in SCOP 1.73
  
• d2oorb2 appears in SCOPe 2.01
  
• d2oorb2 appears in the current release, SCOPe 2.08