SCOP 1.73: Domain d2oohb1: 2ooh B:1-114

Lineage for d2oohb1 (2ooh B:1-114)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (6 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (11 PDB entries)

8. Domain d2oohb1: 2ooh B:1-114 [139169]
   automatically matched to d1gcza_
   complexed with gol, ox3, so4

Details for d2oohb1

PDB Entry: 2ooh, 1.85 Å

PDB Description: crystal structure of mif bound to a novel inhibitor, oxim-11

PDB Compounds: (B:) macrophage migration inhibitory factor

SCOP Domain Sequences for d2oohb1:

Sequence; same for both SEQRES and ATOM records:

>d2oohb1 d.80.1.3 (B:1-114) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d2oohb1:

• d2oohb1 is new in SCOP 1.73
  
• d2oohb1 appears in SCOP 1.75
  
• d2oohb1 appears in the current release, SCOPe 2.08, called d2oohb_