Lineage for d2ooha1 (2ooh A:1-114)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727709Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 727710Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) (S)
  5. 727795Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 727801Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 727807Species Human (Homo sapiens) [TaxId:9606] [55341] (11 PDB entries)
  8. 727814Domain d2ooha1: 2ooh A:1-114 [139168]
    automatically matched to d1gcza_
    complexed with gol, ox3, so4

Details for d2ooha1

PDB Entry: 2ooh (more details), 1.85 Å

PDB Description: crystal structure of mif bound to a novel inhibitor, oxim-11
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOP Domain Sequences for d2ooha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooha1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOP Domain Coordinates for d2ooha1:

Click to download the PDB-style file with coordinates for d2ooha1.
(The format of our PDB-style files is described here.)

Timeline for d2ooha1: