Lineage for d2oo5c_ (2oo5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862854Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2862855Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 2862865Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 2862872Domain d2oo5c_: 2oo5 C: [139166]
    Other proteins in same PDB: d2oo5a1, d2oo5a2, d2oo5b1, d2oo5b2
    automated match to d1hzzc_
    complexed with nap, so4, txd

Details for d2oo5c_

PDB Entry: 2oo5 (more details), 2.6 Å

PDB Description: Structure of transhydrogenase (dI.H2NADH)2(dIII.NADP+)1 asymmetric complex
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d2oo5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oo5c_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOPe Domain Coordinates for d2oo5c_:

Click to download the PDB-style file with coordinates for d2oo5c_.
(The format of our PDB-style files is described here.)

Timeline for d2oo5c_: