| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
| Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species) L-alanine dehydrogenase homologue |
| Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries) |
| Domain d2oo5b1: 2oo5 B:144-326 [139164] Other proteins in same PDB: d2oo5a2, d2oo5b2, d2oo5c_ automated match to d1l7db1 complexed with nap, so4, txd |
PDB Entry: 2oo5 (more details), 2.6 Å
SCOPe Domain Sequences for d2oo5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oo5b1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr
Timeline for d2oo5b1: