Lineage for d2oo5a1 (2oo5 A:144-326)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452504Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2452533Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 2452534Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)
  8. 2452555Domain d2oo5a1: 2oo5 A:144-326 [139162]
    Other proteins in same PDB: d2oo5a2, d2oo5b2, d2oo5c_
    automated match to d1l7db1
    complexed with nap, so4, txd

Details for d2oo5a1

PDB Entry: 2oo5 (more details), 2.6 Å

PDB Description: Structure of transhydrogenase (dI.H2NADH)2(dIII.NADP+)1 asymmetric complex
PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d2oo5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oo5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

SCOPe Domain Coordinates for d2oo5a1:

Click to download the PDB-style file with coordinates for d2oo5a1.
(The format of our PDB-style files is described here.)

Timeline for d2oo5a1: