Lineage for d2onld1 (2onl D:46-385)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries)
  8. Domain d2onld1: 2onl D:46-385 [139161]
    Other proteins in same PDB: d2onla1, d2onlb1
    automatically matched to d1kwpa_

Details for d2onld1

PDB Entry: 2onl (more details), 4 Å

PDB Description: crystal structure of the p38a-mapkap kinase 2 heterodimer
PDB Compounds: (D:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d2onld1:

Sequence, based on SEQRES records: (download)

>d2onld1 d.144.1.7 (D:46-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterease
imksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcy
tpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqye
fpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
kerwedvkeemtsalatmrvdyeqikikkiedasnplllk

Sequence, based on observed residues (ATOM records): (download)

>d2onld1 d.144.1.7 (D:46-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
dkscdmwslgvimyillcgyppfyefpnpewsevseevkmlirnllkteptqrmtitefm
nhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrvdyeqikikkiedasn
plllk

SCOPe Domain Coordinates for d2onld1 are not available.

Timeline for d2onld1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2onla1, d2onlb1, d2onlc1