Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily) multihelical; complex architecture with several transmembrane helices |
Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) automatically mapped to Pfam PF00664 |
Family f.37.1.1: ABC transporter transmembrane region [90124] (3 proteins) |
Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [144088] (2 PDB entries) Uniprot Q99T13 1-323 |
Domain d2onjb2: 2onj B:1-323 [139157] Other proteins in same PDB: d2onja1, d2onjb1 automatically matched to 2HYD A:1-323 complexed with anp, na |
PDB Entry: 2onj (more details), 3.4 Å
SCOPe Domain Sequences for d2onjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onjb2 f.37.1.1 (B:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas fttltqsfasmdrvfqlidedyd
Timeline for d2onjb2: