SCOPe 2.06: Domain d2onjb2: 2onj B:1-323

Lineage for d2onjb2 (2onj B:1-323)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
   multihelical; complex architecture with several transmembrane helices

4. Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families)
   automatically mapped to Pfam PF00664

5. Family f.37.1.1: ABC transporter transmembrane region [90124] (3 proteins)

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [144088] (2 PDB entries)
   Uniprot Q99T13 1-323

8. Domain d2onjb2: 2onj B:1-323 [139157]
   Other proteins in same PDB: d2onja1, d2onjb1
   automatically matched to 2HYD A:1-323
   complexed with anp, na

Details for d2onjb2

PDB Entry: 2onj, 3.4 Å

PDB Description: Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP

PDB Compounds: (B:) Multidrug export ATP-binding/permease protein SAV1866

SCOPe Domain Sequences for d2onjb2:

Sequence; same for both SEQRES and ATOM records:

>d2onjb2 f.37.1.1 (B:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
fttltqsfasmdrvfqlidedyd

Timeline for d2onjb2:

• d2onjb2 first appeared in SCOP 1.73
  
• d2onjb2 appears in SCOPe 2.05
  
• d2onjb2 appears in SCOPe 2.07
  
• d2onjb2 appears in the current release, SCOPe 2.08