SCOPe 2.08: Domain d2onjb1: 2onj B:324-578

Lineage for d2onjb1 (2onj B:324-578)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries)
   Uniprot Q99T13 324-578

8. Domain d2onjb1: 2onj B:324-578 [139156]
   Other proteins in same PDB: d2onja2, d2onjb2
   automatically matched to 2HYD A:324-578
   complexed with anp, na

Details for d2onjb1

PDB Entry: 2onj, 3.4 Å

PDB Description: Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP

PDB Compounds: (B:) Multidrug export ATP-binding/permease protein SAV1866

SCOPe Domain Sequences for d2onjb1:

Sequence; same for both SEQRES and ATOM records:

>d2onjb1 c.37.1.12 (B:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

Timeline for d2onjb1:

• d2onjb1 first appeared in SCOP 1.73
  
• d2onjb1 appears in SCOPe 2.07