Lineage for d2onja2 (2onj A:1-323)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028209Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 3028210Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 3028211Family f.37.1.1: ABC transporter transmembrane region [90124] (4 proteins)
  6. 3028230Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species)
  7. 3028236Species Staphylococcus aureus [TaxId:1280] [144088] (2 PDB entries)
    Uniprot Q99T13 1-323
  8. 3028239Domain d2onja2: 2onj A:1-323 [139155]
    Other proteins in same PDB: d2onja1, d2onjb1
    automatically matched to 2HYD A:1-323
    complexed with anp, na

Details for d2onja2

PDB Entry: 2onj (more details), 3.4 Å

PDB Description: Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP
PDB Compounds: (A:) Multidrug export ATP-binding/permease protein SAV1866

SCOPe Domain Sequences for d2onja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onja2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
fttltqsfasmdrvfqlidedyd

SCOPe Domain Coordinates for d2onja2:

Click to download the PDB-style file with coordinates for d2onja2.
(The format of our PDB-style files is described here.)

Timeline for d2onja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onja1