Lineage for d2onja1 (2onj A:324-578)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870366Protein Putative multidrug export ATP-binding/permease protein SAV1866 [142303] (2 species)
  7. 2870372Species Staphylococcus aureus [TaxId:1280] [142304] (2 PDB entries)
    Uniprot Q99T13 324-578
  8. 2870375Domain d2onja1: 2onj A:324-578 [139154]
    Other proteins in same PDB: d2onja2, d2onjb2
    automatically matched to 2HYD A:324-578
    complexed with anp, na

Details for d2onja1

PDB Entry: 2onj (more details), 3.4 Å

PDB Description: Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP
PDB Compounds: (A:) Multidrug export ATP-binding/permease protein SAV1866

SCOPe Domain Sequences for d2onja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onja1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
ikngvgaqpieikqgrididhvsfqyndneapilkdinlsiekgetvafvgmsgggkstl
inliprfydvtsgqilidghnikdfltgslrnqiglvqqdnilfsdtvkenillgrptat
deevveaakmanahdfimnlpqgydtevgergvklsggqkqrlsiariflnnppililde
atsaldlesesiiqealdvlskdrttlivahrlstithadkivvienghivetgthreli
akqgayehlysiqnl

SCOPe Domain Coordinates for d2onja1:

Click to download the PDB-style file with coordinates for d2onja1.
(The format of our PDB-style files is described here.)

Timeline for d2onja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onja2