Lineage for d2omyb1 (2omy B:-2-100)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657971Superfamily b.1.6: Cadherin-like [49313] (2 families) (S)
  5. 657972Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 657980Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 657981Species Human (Homo sapiens) [TaxId:9606] [81981] (3 PDB entries)
  8. 657982Domain d2omyb1: 2omy B:-2-100 [139153]
    Other proteins in same PDB: d2omya1, d2omya2
    automatically matched to d1o6sb_
    complexed with ca, cl; mutant

Details for d2omyb1

PDB Entry: 2omy (more details), 1.7 Å

PDB Description: crystal structure of inla s192n/hec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOP Domain Sequences for d2omyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omyb1 b.1.6.1 (B:-2-100) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtd

SCOP Domain Coordinates for d2omyb1:

Click to download the PDB-style file with coordinates for d2omyb1.
(The format of our PDB-style files is described here.)

Timeline for d2omyb1: