Lineage for d2omya2 (2omy A:36-416)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690278Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 690329Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 690330Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 690331Protein Internalin A [82324] (1 species)
  7. 690332Species Listeria monocytogenes [TaxId:1639] [82325] (6 PDB entries)
  8. 690335Domain d2omya2: 2omy A:36-416 [139152]
    Other proteins in same PDB: d2omya1, d2omyb1
    automatically matched to d1o6va2
    complexed with ca, cl; mutant

Details for d2omya2

PDB Entry: 2omy (more details), 1.7 Å

PDB Description: crystal structure of inla s192n/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omya2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

SCOP Domain Coordinates for d2omya2:

Click to download the PDB-style file with coordinates for d2omya2.
(The format of our PDB-style files is described here.)

Timeline for d2omya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omya1
View in 3D
Domains from other chains:
(mouse over for more information)
d2omyb1