Lineage for d2omwa2 (2omw A:36-416)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834753Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 1834754Protein Internalin A [82324] (1 species)
  7. 1834755Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)
  8. 1834764Domain d2omwa2: 2omw A:36-416 [139150]
    Other proteins in same PDB: d2omwa1, d2omwb1
    automated match to d2omza2
    complexed with cl

Details for d2omwa2

PDB Entry: 2omw (more details), 1.85 Å

PDB Description: crystal structure of inla s192n y369s/mec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omwa2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

SCOPe Domain Coordinates for d2omwa2:

Click to download the PDB-style file with coordinates for d2omwa2.
(The format of our PDB-style files is described here.)

Timeline for d2omwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2omwb1