Lineage for d2omva2 (2omv A:36-416)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851706Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 2851707Protein Internalin A [82324] (1 species)
  7. 2851708Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)
  8. 2851719Domain d2omva2: 2omv A:36-416 [139147]
    Other proteins in same PDB: d2omva1, d2omva3, d2omvb2, d2omvb3
    automated match to d2omza2
    complexed with ca, cl

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2omva2

PDB Entry: 2omv (more details), 1.9 Å

PDB Description: crystal structure of inla s192n y369s/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omva2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

SCOPe Domain Coordinates for d2omva2:

Click to download the PDB-style file with coordinates for d2omva2.
(The format of our PDB-style files is described here.)

Timeline for d2omva2: