Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
Protein Internalin A [82324] (1 species) |
Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries) |
Domain d2omva2: 2omv A:36-416 [139147] Other proteins in same PDB: d2omva1, d2omva3, d2omvb2, d2omvb3 automated match to d2omza2 complexed with ca, cl applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2omv (more details), 1.9 Å
SCOPe Domain Sequences for d2omva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omva2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi snlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnqi sdltplanltritqlglndqa
Timeline for d2omva2: