![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins) truncated fold fused to an LRR domain |
![]() | Protein Internalin A [81973] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [81974] (6 PDB entries) |
![]() | Domain d2omva1: 2omv A:417-496 [139146] Other proteins in same PDB: d2omva2, d2omvb1 automatically matched to d1o6sa1 complexed with ca, cl; mutant |
PDB Entry: 2omv (more details), 1.9 Å
SCOP Domain Sequences for d2omva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omva1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]} wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp vtigkgtttfsgtvtqplka
Timeline for d2omva1: