SCOP 1.73: Domain d2om9a1: 2om9 A:207-476

Lineage for d2om9a1 (2om9 A:207-476)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (25 PDB entries)

8. Domain d2om9a1: 2om9 A:207-476 [139142]
   automatically matched to d1wm0x_
   complexed with aja

Details for d2om9a1

PDB Entry: 2om9, 2.8 Å

PDB Description: ajulemic acid, a synthetic cannabinoid bound to ppar gamma

PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOP Domain Sequences for d2om9a1:

Sequence; same for both SEQRES and ATOM records:

>d2om9a1 a.123.1.1 (A:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Timeline for d2om9a1:

• d2om9a1 is new in SCOP 1.73
  
• d2om9a1 appears in SCOP 1.75
  
• d2om9a1 appears in the current release, SCOPe 2.08, called d2om9a_