![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [68926] (10 PDB entries) |
![]() | Domain d2olqa2: 2olq A:6-227 [139139] Other proteins in same PDB: d2olqa1 automated match to d1os1a2 complexed with atp, co2, mg, mn |
PDB Entry: 2olq (more details), 1.94 Å
SCOPe Domain Sequences for d2olqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2olqa2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
Timeline for d2olqa2: