Lineage for d2olqa2 (2olq A:6-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920766Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2920770Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)
  8. 2920780Domain d2olqa2: 2olq A:6-227 [139139]
    Other proteins in same PDB: d2olqa1
    automated match to d1os1a2
    complexed with atp, co2, mg, mn

Details for d2olqa2

PDB Entry: 2olq (more details), 1.94 Å

PDB Description: how does an enzyme recognize co2?
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2olqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2olqa2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d2olqa2:

Click to download the PDB-style file with coordinates for d2olqa2.
(The format of our PDB-style files is described here.)

Timeline for d2olqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2olqa1