Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) |
Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins) |
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (3 species) |
Species Escherichia coli [TaxId:562] [53798] (10 PDB entries) |
Domain d2olqa1: 2olq A:228-540 [139138] Other proteins in same PDB: d2olqa2 automatically matched to d1aq2_1 complexed with atp, co2, mg, mn |
PDB Entry: 2olq (more details), 1.94 Å
SCOPe Domain Sequences for d2olqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2olqa1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt pagaalvaagpkl
Timeline for d2olqa1: