| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (6 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries) Uniprot P01887 |
| Domain d2ol3l2: 2ol3 L:1-99 [139134] Other proteins in same PDB: d2ol3a1, d2ol3b_, d2ol3h1, d2ol3h2, d2ol3l3 automated match to d1bz9b_ complexed with nag |
PDB Entry: 2ol3 (more details), 2.9 Å
SCOPe Domain Sequences for d2ol3l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ol3l2 b.1.1.2 (L:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d2ol3l2:
View in 3DDomains from other chains: (mouse over for more information) d2ol3a1, d2ol3b_, d2ol3h1, d2ol3h2 |