![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries) |
![]() | Domain d2ol3h2: 2ol3 H:3-180 [139133] Other proteins in same PDB: d2ol3a1, d2ol3b_, d2ol3h1, d2ol3l2, d2ol3l3 automatically matched to d1ddha2 complexed with nag |
PDB Entry: 2ol3 (more details), 2.9 Å
SCOPe Domain Sequences for d2ol3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ol3h2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
Timeline for d2ol3h2:
![]() Domains from other chains: (mouse over for more information) d2ol3a1, d2ol3b_, d2ol3l2, d2ol3l3 |