SCOPe 2.03: Domain d2ol3h2: 2ol3 H:3-180

Lineage for d2ol3h2 (2ol3 H:3-180)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)

8. Domain d2ol3h2: 2ol3 H:3-180 [139133]
   Other proteins in same PDB: d2ol3a1, d2ol3b_, d2ol3h1, d2ol3l_
   automatically matched to d1ddha2
   complexed with nag

Details for d2ol3h2

PDB Entry: 2ol3, 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule

PDB Compounds: (H:) allogeneic h-2kbm8 MHC class I molecule

SCOPe Domain Sequences for d2ol3h2:

Sequence; same for both SEQRES and ATOM records:

>d2ol3h2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

Timeline for d2ol3h2:

• d2ol3h2 first appeared in SCOP 1.73
  
• d2ol3h2 appears in SCOPe 2.02
  
• d2ol3h2 appears in SCOPe 2.04
  
• d2ol3h2 appears in the current release, SCOPe 2.08