Lineage for d2ol3h2 (2ol3 H:3-180)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198308Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 1198343Domain d2ol3h2: 2ol3 H:3-180 [139133]
    Other proteins in same PDB: d2ol3a1, d2ol3b_, d2ol3h1, d2ol3l_
    automatically matched to d1ddha2
    complexed with nag

Details for d2ol3h2

PDB Entry: 2ol3 (more details), 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule
PDB Compounds: (H:) allogeneic h-2kbm8 MHC class I molecule

SCOPe Domain Sequences for d2ol3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol3h2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOPe Domain Coordinates for d2ol3h2:

Click to download the PDB-style file with coordinates for d2ol3h2.
(The format of our PDB-style files is described here.)

Timeline for d2ol3h2: