Lineage for d2ol3b_ (2ol3 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023862Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2023889Domain d2ol3b_: 2ol3 B: [139131]
    Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l2, d2ol3l3
    automated match to d1namb_
    complexed with nag

Details for d2ol3b_

PDB Entry: 2ol3 (more details), 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule
PDB Compounds: (B:) bm3.3 T-cell receptor beta-chain

SCOPe Domain Sequences for d2ol3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol3b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv

SCOPe Domain Coordinates for d2ol3b_:

Click to download the PDB-style file with coordinates for d2ol3b_.
(The format of our PDB-style files is described here.)

Timeline for d2ol3b_: