Lineage for d2ol3b1 (2ol3 B:1-117)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653994Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 654072Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (19 PDB entries)
  8. 654088Domain d2ol3b1: 2ol3 B:1-117 [139131]
    Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l1
    automatically matched to d1namb_
    complexed with nag

Details for d2ol3b1

PDB Entry: 2ol3 (more details), 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule
PDB Compounds: (B:) bm3.3 T-cell receptor beta-chain

SCOP Domain Sequences for d2ol3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol3b1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv

SCOP Domain Coordinates for d2ol3b1:

Click to download the PDB-style file with coordinates for d2ol3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ol3b1: