![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (17 PDB entries) |
![]() | Domain d2ol3a1: 2ol3 A:1-116 [139130] Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l1 automatically matched to d1nama_ complexed with nag |
PDB Entry: 2ol3 (more details), 2.9 Å
SCOP Domain Sequences for d2ol3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ol3a1 b.1.1.1 (A:1-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
Timeline for d2ol3a1:
![]() Domains from other chains: (mouse over for more information) d2ol3b1, d2ol3h1, d2ol3h2, d2ol3l1 |