Lineage for d2ol3a1 (2ol3 A:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2742002Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2742021Domain d2ol3a1: 2ol3 A:1-116 [139130]
    Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l2, d2ol3l3
    automatically matched to d1nama_
    complexed with nag

Details for d2ol3a1

PDB Entry: 2ol3 (more details), 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule
PDB Compounds: (A:) bm3.3 T-cell receptor alpha-chain

SCOPe Domain Sequences for d2ol3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol3a1 b.1.1.1 (A:1-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp

SCOPe Domain Coordinates for d2ol3a1:

Click to download the PDB-style file with coordinates for d2ol3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ol3a1: