Lineage for d2ok5a4 (2ok5 A:9-76)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749471Protein Complement factor B [144115] (1 species)
    contains tandemrepeat of three SCR (Sushi) domains
  7. 749472Species Human (Homo sapiens) [TaxId:9606] [144116] (1 PDB entry)
  8. 749475Domain d2ok5a4: 2ok5 A:9-76 [139127]
    Other proteins in same PDB: d2ok5a1
    complexed with bma, gol, man, nag

Details for d2ok5a4

PDB Entry: 2ok5 (more details), 2.3 Å

PDB Description: human complement factor b
PDB Compounds: (A:) complement factor b

SCOP Domain Sequences for d2ok5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}
qgscslegveikggsfrllqegqaleyvcpsgfypypvqtrtcrstgswstlktqdqktv
rkaecrai

SCOP Domain Coordinates for d2ok5a4:

Click to download the PDB-style file with coordinates for d2ok5a4.
(The format of our PDB-style files is described here.)

Timeline for d2ok5a4: