![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
![]() | Protein Complement factor B [144115] (1 species) contains tandemrepeat of three SCR (Sushi) domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144116] (1 PDB entry) |
![]() | Domain d2ok5a3: 2ok5 A:77-137 [139126] Other proteins in same PDB: d2ok5a1 complexed with bma, gol, man, nag |
PDB Entry: 2ok5 (more details), 2.3 Å
SCOP Domain Sequences for d2ok5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} hcprphdfengeywprspyynvsdeisfhcydgytlrgsanrtcqvngrwsgqtaicdng a
Timeline for d2ok5a3: