Lineage for d2ok5a1 (2ok5 A:200-452)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2128914Family c.62.1.1: Integrin A (or I) domain [53301] (11 protein domains)
  6. 2128920Protein Complement factor B domain [102541] (1 species)
  7. 2128921Species Human (Homo sapiens) [TaxId:9606] [102542] (5 PDB entries)
    Uniprot P00751 268-764
  8. 2128924Domain d2ok5a1: 2ok5 A:200-452 [139124]
    Other proteins in same PDB: d2ok5a2, d2ok5a3, d2ok5a4, d2ok5a5
    complexed with gol, nag

Details for d2ok5a1

PDB Entry: 2ok5 (more details), 2.3 Å

PDB Description: Human Complement factor B
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d2ok5a1:

Sequence, based on SEQRES records: (download)

>d2ok5a1 c.62.1.1 (A:200-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
dtpqevaeaflssltetiegvdaedghgpgeqqkrkivldpsgsmniylvldgsdsigas
nftgakkclvnliekvasygvkpryglvtyatypkiwvkvseadssnadwvtkqlneiny
edhklksgtntkkalqavysmmswpddvppegwnrtrhviilmtdglhnmggdpitvide
irdllyigkdrknpredyldvyvfgvgplvnqvninalaskkdneqhvfkvkdmenledv
fyqmidesqslsl

Sequence, based on observed residues (ATOM records): (download)

>d2ok5a1 c.62.1.1 (A:200-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
dtpqevaeaflssltetikrkivldpsgsmniylvldgsdsigasnftgakkclvnliek
vasygvkpryglvtyatypkiwvkvseadssnadwvtkqlneinyegtntkkalqavysm
mswvppegwnrtrhviilmtdglhnmggdpitvideirdllyigkdrknpredyldvyvf
gvgplvnqvninalaskkdneqhvfkvkdmenledvfyqmidesqslsl

SCOPe Domain Coordinates for d2ok5a1:

Click to download the PDB-style file with coordinates for d2ok5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ok5a1: